PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1068420.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 225aa    MW: 25962.7 Da    PI: 9.4337
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1068420.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-55181441129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppG+rFhPtdeel+++yL +kv ++++ +  +i+e+d++k+ePwdLp ++k +e ewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
  Lj2g3v1068420.2  18 LPPGYRFHPTDEELITHYLSQKVLDSNFCA-IAIAEADLNKCEPWDLPWMAKMGEGEWYFFCMRDRKYPTGLRTNRATSAGYWKATGKDKEIYR 110
                      79*************************888.78***************87788999************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +++l+g+kktLvfykgrap+gek++Wvmheyrle
  Lj2g3v1068420.2 111 -GKTLIGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 144
                      .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-639169IPR003441NAC domain
PROSITE profilePS5100558.43218169IPR003441NAC domain
PfamPF023654.0E-3019143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEAMVKNFSR EGQQKFKLPP GYRFHPTDEE LITHYLSQKV LDSNFCAIAI AEADLNKCEP  60
WDLPWMAKMG EGEWYFFCMR DRKYPTGLRT NRATSAGYWK ATGKDKEIYR GKTLIGMKKT  120
LVFYKGRAPR GEKSNWVMHE YRLEEDKQSV QNLPKPAMKD WAICRVFEKG AHGKKMHVPF  180
SPFAKEVLLP PLMESSPYNS ETTKTAIGES SHHSHVTSFS DPNQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-53101697168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618528.21e-115NAC transcription factor-like protein
SwissprotQ9FLJ26e-98NC100_ARATH; NAC domain-containing protein 100
TrEMBLG7KKX51e-115G7KKX5_MEDTR; NAC transcription factor-like protein
STRINGGLYMA13G05540.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.13e-99NAC domain containing protein 100